PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.3837s0007.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 232aa    MW: 26492 Da    PI: 8.2607
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.3837s0007.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.95.4e-341973155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprlrWt+eLHerFv+av++LGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Araha.3837s0007.1.p 19 KPRLRWTTELHERFVDAVSHLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 73
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.5181676IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-321674IPR009057Homeodomain-like
SuperFamilySSF466893.23E-171874IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-241974IPR006447Myb domain, plants
PfamPF002492.0E-82171IPR001005SANT/Myb domain
PfamPF143791.5E-14120159IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MMQSRDESSS GLVLTTDPKP RLRWTTELHE RFVDAVSHLG GPDKATPKTI MRVMGVKGLT  60
LYHLKSHLQK FRLGKQPHKE HSQNHSISIR DTNRASMLDL RRNGVFTTSP LIIGRNMNDM  120
QMEVQRRIEE EVEIERQVNQ RIEAQGKYME SMLEKAYETQ EASLTKDYST LFFDRTNICN  180
NTSSIPIQWF EDHFPSSSSM DSALIIPDIN SNFSLQDSRS SITKGRTVCL G*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00351DAPTransfer from AT3G12730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0707640.0AY070764.1 Arabidopsis thaliana AT3g12730/MBK21_9 mRNA, complete cds.
GenBankAY1439160.0AY143916.1 Arabidopsis thaliana At3g12730/MBK21_9 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187879.21e-162myb family transcription factor
SwissprotQ9SAK56e-71APL_ARATH; Myb family transcription factor APL
TrEMBLQ8VYI21e-162Q8VYI2_ARATH; AT3g12730/MBK21_9
STRINGAT3G12730.11e-162(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137451726
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12730.11e-149G2-like family protein